Total number of results for Penaeus japonicus are 12
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP00706 |
SPVDAFSPPEASLTGGQSLS
|
20 | Penaeus japonicus | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide 1 | ||
| NP00707 |
SLFDPSCTGVFDRQLLRRLGRVCDDCFNVFREPNVATECRSNCYNNPVFRQCMAYVVPAHLHNEHREAVQMV
|
72 | Penaeus japonicus | Arthropod CHH/MIH/GIH/VIH hormone | Crustacean hyperglycemic hormone 1 | 9210164#Yang W.-J., Aida K., Nagasawa H.; #Amino acid sequences and activities of multiple hyperglycemic hormones from the kuruma prawn, Penaeus japonicus.; #Peptides 18:479-485(1997). | |
| NP00708 |
DAFSPPEASLTGGQSLS
|
17 | Penaeus japonicus | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide 2 | ||
| NP00709 |
SLFDPSCTGVFDRQLLRRLGRVCDDCFNVFREPNVAMECRSNCYNNPVFRQCMEYLLPAHLHDEYRLAVQMV
|
72 | Penaeus japonicus | Arthropod CHH/MIH/GIH/VIH hormone | Crustacean hyperglycemic hormone 2 | 9210164#Yang W.-J., Aida K., Nagasawa H.; #Amino acid sequences and activities of multiple hyperglycemic hormones from the kuruma prawn, Penaeus japonicus.; #Peptides 18:479-485(1997). | |
| NP00710 |
RSFDASPSATSGNHSLN
|
17 | Penaeus japonicus | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide 3 | ||
| NP00711 |
SLFDPACTGIYDRQLLRKLGRLCDDCYNVFREPKVATGCRSNCYHNLIFLDCLEYLIPSHLQEEHMAAMQTV
|
72 | Penaeus japonicus | Arthropod CHH/MIH/GIH/VIH hormone | Crustacean hyperglycemic hormone 3 | ||
| NP00712 |
RSSEDLSAPEDRSLS
|
15 | Penaeus japonicus | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide 5 | ||
| NP00713 |
LVFDPSCAGVYDRVLLGKLNRLCDDCYNVFREPNVATECRSNCFYNLAFVQCLEYLMPPSLHEEYQANVQMV
|
72 | Penaeus japonicus | Arthropod CHH/MIH/GIH/VIH hormone | Crustacean hyperglycemic hormone 5 | 9210164#Yang W.-J., Aida K., Nagasawa H.; #Amino acid sequences and activities of multiple hyperglycemic hormones from the kuruma prawn, Penaeus japonicus.; #Peptides 18:479-485(1997). | |
| NP00714 |
RSLEGSSSPVTSLTRGRSLN
|
20 | Penaeus japonicus | Arthropod CHH/MIH/GIH/VIH hormone | CHH precursor-related peptide 7 | ||
| NP00715 |
AAFDPSCTGVYDRELLGRLSRLCDDCYNVFREPKVAMECRSNCFFNPAFVQCLEYLIPAELHEEYQALVQTV
|
72 | Penaeus japonicus | Arthropod CHH/MIH/GIH/VIH hormone | Crustacean hyperglycemic hormone 7 | ||
| NP00716 |
SFIDNTCRGVMGNRDIYKKVVRVCEDCTNIFRLPGLDGMCRNRCFYNEWFLICLKAANREDEIEKFRVWISILNAGQ
|
77 | Penaeus japonicus | Arthropod CHH/MIH/GIH/VIH hormone | Molt-inhibiting hormone | 8801521#Yang W.-J., Aida K., Terauchi A., Sonobe H., Nagasawa H.; #Amino acid sequence of a peptide with molt-inhibiting activity from the kuruma prawn Penaeus japonicus.; #Peptides 17:197-202(1996). | |
| NP00764 |
NSELINSLLGIPKVMTDA
|
18 | Penaeus japonicus | Arthropod PDH | Pej-PDH-I | 10336829#Yang WJ, Aida K, Nagasawa H#Characterization of chromatophorotropic neuropeptides from the kuruma prawn Penaeus japonicus#Gen Comp Endocrinol 1999 Jun;114(3):415-24 |